SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006726 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006726
Domain Number 1 Region: 78-161
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.23e-17
Family DBL homology domain (DH-domain) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006726   Gene: ENSEEUG00000007406   Transcript: ENSEEUT00000007373
Sequence length 166
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4304:829:14733:1 gene:ENSEEUG00000007406 transcript:ENSEEUT00000007373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPKDREQLGCRRKNLLFLRPRLYMLERRNTDTAVDSMAAGDRAGPLRRSQSDRTEYGQR
LQEKMTPQAECCAAESLTQEEEQRTQRMMTKRLRVIQELVQTERDYKHDLELCIREVVQP
LRDKQVDGLDVDTFFSNIESVQQVSATLLSLLEEATTDVEPARQVI
Download sequence
Identical sequences ENSEEUP00000006726 ENSEEUP00000006726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]