SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006820 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006820
Domain Number 1 Region: 2-254
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.15e-51
Family Mitochondrial carrier 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006820   Gene: ENSEEUG00000007473   Transcript: ENSEEUT00000007478
Sequence length 254
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7742:6280:262909:-1 gene:ENSEEUG00000007473 transcript:ENSEEUT00000007478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVEISLMHPLDVVKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLFGFYKGILPPILAET
PKRAVKFFTFEQYKKLLGYVSLSPAVTFALAGLGSGLTEAIVVNPFEVVKVGLQANRNTF
TEQPSTWSYARHIIRNQSLGLQGLNKGLSATLGRHGVFTMVYFEFYYVKNMIPVNKDPTL
EFLRRFGIGLLSGTFASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATIYQEEGILA
LYKGLLPKIMRLGP
Download sequence
Identical sequences ENSEEUP00000006820 ENSEEUP00000006820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]