SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006871 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006871
Domain Number 1 Region: 542-728
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-53
Family DBL homology domain (DH-domain) 0.000000203
Further Details:      
 
Domain Number 2 Region: 736-862
Classification Level Classification E-value
Superfamily PH domain-like 6.37e-33
Family Pleckstrin-homology domain (PH domain) 0.0000183
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000006871
Domain Number - Region: 38-137
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000114
Family CRAL/TRIO domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006871   Gene: ENSEEUG00000007497   Transcript: ENSEEUT00000007542
Sequence length 959
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1528:144627:257169:-1 gene:ENSEEUG00000007497 transcript:ENSEEUT00000007542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQGRDNTWIITFPENCHFRCIPEDVLAKVLIYLTSIVWQDGVVPRFTIILDRRLDTWSSL
KISLQKISVSFPGNLHLVLVLRPTSFLQRTFTDIGFRFSQEDFMLKLPVVMLSSVSDLLT
YIDDKQLTPELGGTLQYCHSEWIIFRNAIENFALTVKEMAQMLQSFGTELAETELPDDIP
SIEEVIAHRAERYHLLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXLLAQVHDMEIAFDGFWEKHQLKMEQYVQLWKFEQDFQEXXADVELLLNQQAELADITG
NLSQVKHKLKKLDKLDENSQXXXXXXXXXXXXXXXXXXXXXYALDLICQRCNELRYLSDV
LPNEIKAKRVQLSRTVKMHKLLQQARQCCDEGEYLLANQDRDKFQTKEDAEKALQDIENF
LEMALPFINYDPENLEYEFDVILSPELKAQMQTVQLKLENIRSIFADQQAGFRNLTDKHL
NPIPFVVASDNFSRSRVPFFSPKHGKKTWRQNQSNLKIEVVHDCQEKRPMGQPSNLDNDN
SLNVLKNHVLNELVQTERVYVHELFTVLLGYMAEMDNPEMFELMPPLLRNKKDVLFGNMA
EIYEFHNNIFLDSLENCLHAPERVGPCFLERKDDFQMYALYCQNKPRSELIWKKYSECAF
FQECQRKLKHRLGLDSYLLKPVQRITKYQLLLKELLKYSQGCEGYDQLKEALDTMLDILK
SVNDSMHQIAINGYIGNLNELGRMITQSAFSVWIGHKKGATKMKDFARFKPMQRHLFLYE
KAIVFCKRRAESGEERYPSYSFKHCLKMDEVGITEYVKGDSRKFEIWCSGKEEVYIVQAP
NIDVKLIWLKEMRSILLKQRELMTARNRVLCNQLMEQDRFSSQQNDDKQQGAFLRSEEAE
SAPSSRVVEVGDAISSLQAEASAVWTEMLPHSELTAEPDEWSRNYFYSPYDDNEEGKLM
Download sequence
Identical sequences ENSEEUP00000006871 ENSEEUP00000006871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]