SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006907 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006907
Domain Number 1 Region: 299-603
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.64e-110
Family Mammalian PLC 0.000000498
Further Details:      
 
Domain Number 2 Region: 139-297
Classification Level Classification E-value
Superfamily EF-hand 1.86e-37
Family EF-hand modules in multidomain proteins 0.018
Further Details:      
 
Domain Number 3 Region: 624-748
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.52e-32
Family PLC-like (P variant) 0.00042
Further Details:      
 
Domain Number 4 Region: 10-123
Classification Level Classification E-value
Superfamily PH domain-like 2.26e-26
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006907   Gene: ENSEEUG00000007592   Transcript: ENSEEUT00000007580
Sequence length 996
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2589:86650:172102:1 gene:ENSEEUG00000007592 transcript:ENSEEUT00000007580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSEKKSSASDCISFMQAGCELKKVRPNSRIYNRFFTLDTDLQALRWEPSKKDLEKAKLD
ISAIKEIRLGKNTETFRNSGLADQICEDCAFSILHEENYESLDLVANSADVANIWVSGLR
YLVSRSKQPLDFMEDNQNTPRFLWLKTVFEAADIDGNGIMLEDTSVELIKQLNPTLKESK
IRLKFKEIQKSKEKLTTRVTEEEFCEAFYELCTRPEVYFLLVQISKNKEYLDANDLMLFL
EAEQGVTHITEEMCLDIIRRFEFSEEGRQKGFLAIDGFTQYLLSPECDIFDPEQKKVAQD
MTQPLSHYYINASHNTYLIEDQFRGPADINGYVRALKMGCRSIELDVSDGTDNEPILCNR
NNMTPHLSFRSVIEVINKFAFTASEYPLILCLGNYCSLPQQKIMAQQMKKVFGSKLYTDA
PLPSESYLPSPEKLKKMIIVKGKKLPSDLDVLEGEVTDEDEEAEMSQRMSADCNGEQKQI
WLCRELSDLVSICKSVQYRDFELSMKNQNYWEICLFTETEASRIANEYPEDFVNYNKKFL
SRIYPSAMRIDSSNLNPQDFWNCGCQIVAMNFQTPGPMMDLHTGWFLQNGGCGYVLRPSI
MRDEVSYFSANTKGIVPGVSPLALHIKIISGQNFPKPKGACAKGDVIDPYVCIEIHGIPA
DCSEQRTKTVQQNSDNPIFDETFEFQVNLPELAMIRFVVLDDDYIGDEFIGQYTIPFECL
QPGYRHVPLRSFVGEVMEHVTLFVHVAMTNRSGGGKSQKRSLSVRMGKKVREYTMLRNIG
LKTIDDVFKIAVHPLREAIDMRENMQNAIVSVKELCGLPPIASLKQCLLTLSSRLITSDN
TPSVCLMMKDSFPYLEPLGSIPDVQKKMLAAYDLMIQESRFLIEVADTVQEKIVQCQKSG
MKFHEELHNLGAKEGLKGRKLNKATESFAWNITVLKGQGDLLKNAKNEAIENMKQIQLAC
LSCGLSRSPSNGTEAKSKRSLEAIEEKESSEENGKL
Download sequence
Identical sequences ENSEEUP00000006907 ENSEEUP00000006907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]