SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006961 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006961
Domain Number 1 Region: 546-814
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-80
Family Protein kinases, catalytic subunit 0.00000131
Further Details:      
 
Domain Number 2 Region: 436-575
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-26
Family SH2 domain 0.00089
Further Details:      
 
Domain Number 3 Region: 12-127
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.09e-17
Family FCH domain 0.028
Further Details:      
 
Domain Number 4 Region: 220-280
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000732
Family BAR domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006961   Gene: ENSEEUG00000007616   Transcript: ENSEEUT00000007641
Sequence length 819
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4430:19842:32012:1 gene:ENSEEUG00000007616 transcript:ENSEEUT00000007641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFSSELCSPQGHGAVQQLQEAELRLLEGMRKWMAQRVRSDREYAGLLHHMSLQDGGGRG
LPDSPVSQSWAEITSQTEGLSRVLRQHAEDLNSGPLSKLSVLIRERQLMRKSYSEQWQQL
QQELAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDILQEYLEISSLVQDEVAS
IHREMASAAARIQPEAEYHGFLRQYGTAPDVPPCVTFDESLLEEGEALEPGELQLNELTV
ESVQHTLTAVTDELASATDTVVSRQEAVVQLQQELQDEKQSTHPRERVQLLGKKQALQEA
LQALQVALCSQAKLQAQHELLQAKVRQLGPGEPPPVLLLQDDRHSTSSSEPEREGGRTPT
LEILKSHISGIFRPRFSLPPPLQLVPEVQKPLHEQLWYHGAIPRTEVAELLTHSGDFLVR
ESQGKQESVLSVLWDGQPRHFIIQSSDNLFRLEGDGFPSIPLLIDHLLHSQQPLTKKSGV
VLNRAVPKDKWVLNHEDLVLGEQIGRGNFGEVFSGRLRADNTPVAVKSCRETLPPELKAK
FLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTYLRTEGSRLRVKTLLQL
VGDAAAGMAYLESKCCIHRDLAARNCLVTEKNVLKISDFGMSREEADGIYAASGGLRQVP
VKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYPNLSNQQTREFVENGGRLPCPE
LCPDAVFRLMEQCWAYESGQRPSFSTICQELHSIRKRHR
Download sequence
Identical sequences ENSEEUP00000006961 ENSEEUP00000006961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]