SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007022 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007022
Domain Number 1 Region: 62-152
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-26
Family PDZ domain 0.0017
Further Details:      
 
Domain Number 2 Region: 145-235
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000467
Family Pleckstrin-homology domain (PH domain) 0.055
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000007022
Domain Number - Region: 291-420
Classification Level Classification E-value
Superfamily PH domain-like 0.00032
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007022   Gene: ENSEEUG00000007683   Transcript: ENSEEUT00000007707
Sequence length 537
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7100:59931:238427:1 gene:ENSEEUG00000007683 transcript:ENSEEUT00000007707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEGHPPPAVPRGPPGRLLVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXHRTVTLRRQPVGGLGLSIKGGAEHGVPVVLSKIFKDHAADQSGMLFIGDAVL
QVNGINVENATHEEVVHLLRNAGNEVTLTVEYLREAPSFLKLPLGSPGPSSDHSSGASSP
LFDSGLHLNGNSSNTAPSSPSSPIANEPKYEKRWLDTLSVPLSMARISRYKAGTEKLXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMKMANKCCSPCDQVVHMGW
VTERLEGAGSSQIFRSKFLALKGCSFYIFSTPPVSTLDWVRAEKSYNLCEVLFKVHKFWL
TDDCWLQANLYLGLHDFDFEEKKPYCFSVMVSHGKSHVFNVELGSELAVWEKSFQRATFM
EVQRTGSKTYMCTWQGEMLCFTVDFALGFTCFDSKTKNVLWRFKFSQLKGSSDDGKTRVK
LLFQNLDTKQIEMKELEFQDLTGVLHCIHSFIAAKVASVDPMFIDSQSVTRRYMYSN
Download sequence
Identical sequences ENSEEUP00000007022 ENSEEUP00000007022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]