SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007056 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007056
Domain Number 1 Region: 71-125
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000404
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0019
Further Details:      
 
Domain Number 2 Region: 1106-1147
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000296
Family Synaptotagmin-like (S variant) 0.048
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000007056
Domain Number - Region: 254-308
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000622
Family Synaptotagmin-like (S variant) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007056   Gene: ENSEEUG00000007693   Transcript: ENSEEUT00000007747
Sequence length 1148
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4159:8086:141750:1 gene:ENSEEUG00000007693 transcript:ENSEEUT00000007747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGRGLYGIDSMPDLRRKKTLPIVGDVVXXXXXXXXXXXXXXXXXXXXXXXXXKIHVFKKT
LQALIYPMSSTTPHNFEVWTATTPTYCYECEGLLWGIARQGVKCLECGVKCHEKCQELLS
ADCLQRAAEKSSKHGAEDKTQTIISAMKERMKIREKNRPEVFEVIQEMFQISKEDFVQHT
KAAKQSVLDGTSKWSAKITITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXECHNSTDRIKVRVWDEDDDIKARVKQHFKKESDDFLGQTIVEVRTLSGEMD
VWYNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLFHYLTEVKSNGGVK
IPEVKGDEAWKVFFDDASQEIVDEFAMRYGVESIYQAMTXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXREKFIKLLDQLHNSLRIDLSKYRENFPAS
NSDRLQDLKSTVDLLTSITFFRMKVLELQSPPKASMVVKDCVRACLDATYKYIFDNCHEL
YSQLIDPNKKQDIPREDQGPSTKNLDFWPQLITLMVTIIDEDNTAYTPVLNQFPQELNMG
KVSADIMWTLFAQDMKYALEEHEKQRLCKSTDYMNLHFKVKWFYNEYVRELPAFKDTVPE
YSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFQQTSDHALFSCSVVDVFAQLNQSF
EIIKKLECPNPEALSHFMRRFAKTINKVLLQYAAIISSDFSSHCDKENVPCILMNNIQQL
RVQLEKMFESMGGKELDAEASAILTELQIKLSGVLDGLSVTYGESFQLTIEECIKQMSFE
LNQMRTDGNPASNTNIATMDAEVVLRPLMDFLDKTLSLSAKICEKTVLKRVLKELWKLVL
NKIEKQIVLPPLTDQTGPQMIFIAAKDLGQLSKLKEHMTGENARGLTPRQCSIVEVVLAT
VKQYFHAGGNGLKKNYLEKSPDLQSLRYALSLYTQTTDALIKRFIATQTAQSLSSKDSVG
QISIHVDITTTPGTGEHKVTVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXILSQENRPGAYELHLSVKDYCFAREDRVIGTTVIQLQSIADKGS
HGAWYPLL
Download sequence
Identical sequences ENSEEUP00000007056 ENSEEUP00000007056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]