SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007095 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007095
Domain Number 1 Region: 555-640
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000196
Family 28-residue LRR 0.066
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000007095
Domain Number - Region: 25-68
Classification Level Classification E-value
Superfamily PH domain-like 0.000616
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007095   Gene: ENSEEUG00000007751   Transcript: ENSEEUT00000007789
Sequence length 654
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5367:4785:77276:1 gene:ENSEEUG00000007751 transcript:ENSEEUT00000007789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTGYMENSVSYSAIEDVQLLSWENAPKYCLQLTIPGGTVLLQAANSYLRDQWFHSLQWKK
KIYKYKKVLSNPSRWEVVLKEIRTLVDMALTSPLQDDSINQAPLEIVSKLLSENTNLTTQ
EHENIIVAIAPLLENNHPPPDLCEFFCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMHGPTGHCPHPRVLPNLVAVCLAAIYSCYE
EFINSRDNSPSLKEIRNGCQQPCDRKPNLPLRLLHPSPDLVSQEATLSEARLKSVVVASS
EIHVEVEHTSTAKPALTASVGNDSEPNLIDCLMVSPACSTMSIELGPQADRTLGCYVEIL
KLLSDYDDWRPSLASLLQPIPFPKEALAHEKFTKELKYVIQKFAENPRQEVHSCLLSVRA
GKDGWFQLYSPGGVACDDDGELFASMVHILMGSCYKTKKFLLSLAENKLGPCMLLALRXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQRKGGPTR
LTLPSKSTDADLARLLSSGSFGNLENLSLAFTNVTSACAEHLIKLPSLKQLNLWSTQFGD
AGLRLLSEHLTMLQVLNLCETPVTDAGLLALSSMKSCSLMNSTKLSADTYEDLK
Download sequence
Identical sequences ENSEEUP00000007095 ENSEEUP00000007095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]