SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007139 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007139
Domain Number 1 Region: 2-82
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000000000102
Family Type II chitinase 0.043
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000007139
Domain Number - Region: 485-605
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000633
Family Laminin G-like module 0.053
Further Details:      
 
Domain Number - Region: 202-278
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0101
Family beta-glycanases 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007139   Gene: ENSEEUG00000007816   Transcript: ENSEEUT00000007838
Sequence length 620
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_445:18571:42973:-1 gene:ENSEEUG00000007816 transcript:ENSEEUT00000007838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYALDENY
FRGYEWWLMKEAKKRNPNIILMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXIWNERSFDINYIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXAHYPGTRTVKDAVLTEKKLWSSEDFSTVNSDLGAGCWGRILNQNYINGFMTSSI
AWNLVASYYPQLPYGRCGLMTAQEPWSGHYQVDSPIWVSXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXSHKHSMCIRPFLPYFNVSHQLAHFTLKGSFXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXLLDSGSNFTLELEEDELFTLTTLTSGRKGSYPPPPPSKP
FPHSYKEDFNVDYPFFSEAPNFADQTGVFEYFMNIEDPGEHRFTLRQVLNQRPITWAADA
SSTISIIGDYTWSNLTIKCDVYIETPERGGVFIAGRVNKGGILIRSARGIFFWIFSNGTY
RVTGDLAGWLVYAMGHADVTAKEWYTLTLTIKGHLSSGMLNGRPLWRKVHTSFPKNGWAA
IGTHSFAFAQFDNFHVEASH
Download sequence
Identical sequences ENSEEUP00000007139 ENSEEUP00000007139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]