SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007180 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007180
Domain Number 1 Region: 84-156
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000777
Family Pleckstrin-homology domain (PH domain) 0.0000324
Further Details:      
 
Domain Number 2 Region: 779-821,913-950,1286-1421
Classification Level Classification E-value
Superfamily ARM repeat 0.00000698
Family Mo25 protein 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007180   Gene: ENSEEUG00000007688   Transcript: ENSEEUT00000007882
Sequence length 1964
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1090:46411:259973:-1 gene:ENSEEUG00000007688 transcript:ENSEEUT00000007882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAVLRRQGRYGCSTVPANAQEEAQSLFVTECIKTYNSDWHLVNYKYEDYSGEFRQLPNKV
AKLDKLPVHVYEVDEEVDKDEDAASLGSQKGGITKHGWLYKGNMNSAISVTMRSFKRRFF
HLIQLGDGSYNLNFYKDEKISKEPKGSIFLDSCMGVVQXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGQSKLESPGSGLDSYLPELAKS
AREAEIKLKSESRVKLFYLDPDAQKLDFSSAEPEVKPFEEKFGKRILVKCNDLSFNLQCC
VAENEEGPTTNVEPFFVTLSLFDIKYNRKISADFHVDLNHYSVRQMLASTSPVLMNGGGR
SSPALQAILHEAAMQFPKQGIFSITCPHPDIFLVARIEKVLQGSITHGAEPYMKSSDSSK
XXXXXXXXXXXXXXXXXXXXXXXXXXXXTLFKDASGNLDKNARFSALYRQDSNKLSNDDM
LKLLADFRKPEKMAKLPVILGNLDITIDNVSSDFPNYVNSSYIPMKQFETCSKSPLTFEV
EEFVPCIPKHTQPYTIYNNHLYVYPKYLKYDSQKSFAKARNIAICIEFKDSDEEDSQPLK
CIYGRPGGPVFTRSAFAAVLHHHQNPEFYDEIKIELPTQLHEKHHLLFTFFHVSCDNSNK
GSTKKKDVVETQVGYSWLPLLKDGRVVTNEQHVPVSANLPAGYLGYQELGMGRXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLHAMEGH
VMIAFLPTILNQLFRVLTRATQEEVAVNVTRVIIHVVAQCHEEGLESHLRSYVKYAYKAE
PYVASEYKTVHEELAKSMTTILKPSADFLTSNKLLKYSWFFFDVLIKSMAQHLIENSKVK
LLRNQRFPASYHHAVETVVNMLMPHITQKFRDNPEASKNANHSLAVFIKXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNHEHYIPLNLPMPFGKGRIQRYQDLQLGY
SLTDEFCRNHFLVGLLLREVDTALQEFREVRLIAISVLKNLLIKHSFDDRYTSKSHQARI
ATLYLPLFGLLIENVQRINVRDVSPFPVNPGSTVKEESLSLQAVNPLVTPQKSANTLDTS
LHKDLFATIGGIASPYTVSTPNINSVRNADSRGSLISTDSGNSLPERNSEKSNSLDKNQQ
SGTLGNNLVRCDKLDQSEIKSLLMCFLYILKSMSDDALFTYWNKASTSELMDFFTISEVC
LHQFQYMGKRYIASGNRTRMMHVKLQELAGPCNLSPLFTPXYVRQSFVAERCNQLLADHG
HNPLMKKVFDVYLCFLQKHQSETALKSVFTALRSLIYKFPSTFYEGRADMCAALCYETLK
CCNSKLSSIRTEASQLLYFLMRNNFDYTGKKSFVRTHLQVIISVSQLIADVVGIGGTRFQ
QSLSIINNCANSDRLIKHTSFSSDVKDLTKRIRTVLMATAQMKXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAAMCYVHVTALVAEYLTRKXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDVLMELLEQCADG
LWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMQSGRRLLGTYFR
VAFFGQAAQYQFTDSETDVEGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSEKFGSEN
VKMIQDSGKVNPKDLDSKYAYIQVTHVTPFFDEKELQERKTEFERSHNIRRFMFEMPFTQ
TGKRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQ
LCSSAEVDMIKLQLKLQGSVSVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQFV
EACGQALVVNERLIKEDQLEYQEEMKANYREMAKELSEIMREQV
Download sequence
Identical sequences ENSEEUP00000007180 ENSEEUP00000007180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]