SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007261 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007261
Domain Number 1 Region: 13-294
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.96e-75
Family Mitochondrial carrier 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007261   Gene: ENSEEUG00000007994   Transcript: ENSEEUT00000007970
Sequence length 309
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_271781:1444:4150:-1 gene:ENSEEUG00000007994 transcript:ENSEEUT00000007970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGFKATDIPPTTTVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGAVRVAASARYH
GVLGTIMTMVRTEGPCSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSESAGIGSRL
LAGSTTGAMAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVEAYKIIAREEGFRGLWKGTS
PNIARNAIVNCAELVSYDLIKDALLKAHLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT
RYMNSALGQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA
AHVSREAPI
Download sequence
Identical sequences ENSEEUP00000007261 ENSEEUP00000007261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]