SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007267 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007267
Domain Number 1 Region: 43-243
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.02e-68
Family Arfaptin, Rac-binding fragment 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007267   Gene: ENSEEUG00000007977   Transcript: ENSEEUT00000007976
Sequence length 477
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1885:97259:321990:-1 gene:ENSEEUG00000007977 transcript:ENSEEUT00000007976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYPWDIQDRYGQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSI
QRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFSSQQ
RLALRNPLCRFHQEVETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKDVSQELDPDLYK
QMEKFRKVQTQVRLAKKSFDKLKMDVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKTS
HTMAAIHESFKGYQPYEFTTLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLISLE
DENQHQESSSFKIENEKSVLNFFDSSSTHNACTRPLDELLDVKPGEGACLGPMPGTLEPD
SSDKDDLLLLSEIFSISSLEEGEFSKEWAAVFGDDRLKEAAPTGAPGEVDPKPQTGAGFL
PSQLLDQNMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAIGRTDKEHELLNA
Download sequence
Identical sequences ENSEEUP00000007267 ENSEEUP00000007267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]