SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007285 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007285
Domain Number 1 Region: 20-154
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-45
Family Regulator of G-protein signaling, RGS 0.0000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007285   Gene: ENSEEUG00000008026   Transcript: ENSEEUT00000007998
Sequence length 159
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_340209:10920:38882:-1 gene:ENSEEUG00000008026 transcript:ENSEEUT00000007998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQNCWLCKVCRNKLKRPPSNLTLEEVLQWAQSFEKLMATKYGPIIYSAYLKMEHSDEN
IKFWMACENYKKIASQWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTQAC
FEEAQRIVYMHMERDSYPRFLKSEMYQTLLKTIQSNNNS
Download sequence
Identical sequences A0A1S3ASN9
XP_007539809.1.11023 ENSEEUP00000007285 ENSEEUP00000007285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]