SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007347 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007347
Domain Number 1 Region: 67-152
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.53e-25
Family Thyroglobulin type-1 domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007347   Gene: ENSEEUG00000008099   Transcript: ENSEEUT00000008066
Sequence length 156
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_282729:40:1897:1 gene:ENSEEUG00000008099 transcript:ENSEEUT00000008066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NDSESEEVRGDGSVENQVTAVTHQAPDSKLPPLHTKAAAIKKGHAKDTQRYKVDYETQNT
DTQNFSWESKRETEYGPCRREMEDILNYFKFENILSLRTVHIPNCDKKGFYKKKQCRPSK
GRKRGVCWCVDKYGQPLPGYDTKGKGDVQCYHTESK
Download sequence
Identical sequences ENSEEUP00000007347 ENSEEUP00000007347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]