SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007349 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007349
Domain Number 1 Region: 66-107
Classification Level Classification E-value
Superfamily FKBP-like 0.00000000000000354
Family FKBP immunophilin/proline isomerase 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007349   Gene: ENSEEUG00000008096   Transcript: ENSEEUT00000008068
Sequence length 108
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1099:43247:48152:-1 gene:ENSEEUG00000008096 transcript:ENSEEUT00000008068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVQVETISPKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXMSVGQRAKLIISPDYAYGSTGHPGIIPPNATLVFDVELLKLE
Download sequence
Identical sequences ENSEEUP00000007349 ENSEEUP00000007349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]