SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007355 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007355
Domain Number 1 Region: 16-134
Classification Level Classification E-value
Superfamily FKBP-like 2.55e-32
Family FKBP immunophilin/proline isomerase 0.00017
Further Details:      
 
Domain Number 2 Region: 112-205
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000922
Family Calbindin D9K 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007355   Gene: ENSEEUG00000008100   Transcript: ENSEEUT00000008074
Sequence length 211
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_257300:8835:22790:-1 gene:ENSEEUG00000008100 transcript:ENSEEUT00000008074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLLWNAVWTLLVTPLSGALIPEPEVKIEVLQKPFICHRQTKGGDLMLVHYEGFLEKDG
SLFHSTHKHNQGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLTIPPALGYGREGKGKIP
PESTLIFNIDLLEIRNGPRSHESFQQMDLNDDWKLSKDEVKVYLKKEFEKHGAVVNESHH
DVLVEDIFDKEDEDKDGFISAREFTYKHDEL
Download sequence
Identical sequences A0A1S3WRS8
XP_007535456.1.11023 XP_016049050.1.11023 ENSEEUP00000007355 ENSEEUP00000007355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]