SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007388 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007388
Domain Number 1 Region: 2-229
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.53e-49
Family FCH domain 0.01
Further Details:      
 
Domain Number 2 Region: 302-351
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000197
Family SH3-domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007388   Gene: ENSEEUG00000008123   Transcript: ENSEEUT00000008110
Sequence length 353
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_202948:1526:7731:1 gene:ENSEEUG00000008123 transcript:ENSEEUT00000008110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQYGTLEKAWHAFFTSAERLSALHLEVREKLQGQDSERVRAWQRGAFHRPVLGGFRESRA
AEDSFRKAQKPWLKRLKEVEASKKSYHAARKEEKTAQTRESHAKADSAVSQEQLRKLQER
VDRCAREAEKVKAQYEQTLAELHRYTPRYMEDMEQAFETCQTAERQRLLFFKDMLLTLHQ
HLDLSSSERFQELHRDLHKGIEAASDEEDLRWWRSTHGPGMAMNWPQFEVWSLDTQKTIT
RKEKGGRSPDEVTLTSIVATKDCTASPPQSPVPPRXXXXXXXXXXXXXXXXXXXXXXXXX
XXYAAQEADELSFRAGEELLKMSEEDEQGWCQGQLQSGRIGLYPANYVECVGA
Download sequence
Identical sequences ENSEEUP00000007388 ENSEEUP00000007388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]