SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007420 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007420
Domain Number 1 Region: 1085-1225,1292-1568
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.24e-99
Family Myotubularin-like phosphatases 0.0000118
Further Details:      
 
Domain Number 2 Region: 1623-1826
Classification Level Classification E-value
Superfamily PH domain-like 1.59e-29
Family Pleckstrin-homology domain (PH domain) 0.0000274
Further Details:      
 
Domain Number 3 Region: 856-998
Classification Level Classification E-value
Superfamily PH domain-like 3.89e-17
Family GRAM domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007420   Gene: ENSEEUG00000008016   Transcript: ENSEEUT00000008144
Sequence length 1829
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3727:1864:116778:-1 gene:ENSEEUG00000008016 transcript:ENSEEUT00000008144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGAGLGKIIQRFPQKDWEDTPFPQGIELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXGTKKEAVEGEVEVSSLIQPAEVFAPKSLVLVSRLDYPEIFRACLGL
IYTVYVDSLNVSLESLVANLCACLVPATGGSQXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPYIPILP
AQLLEVLSSPTPFIIGVHSVFKADVHELLDVIIADLDGGTIKVPECIHLSSLPEPLLHQT
QAALSLILHPDLEVADHAFPPPRTALSHSKMLDKEVRAVFLRLFAQLFQGYRSCLQLIRI
HAEPXXXXXXTAFLGQRGLVENDFLIKVLNGMAFAGFVSERGPPYRPCDLFDELVAFEVE
RIKVEESNPLKMIKHVRELAEQLFKNENPNPHMAFQKVPRPTEGSHLRVHILPFPKINEI
RVQELIQENLAKNQNAPPASRMEKKCVVPAGPPVVSIMDKVTTVFNSAQRLEVVRNCISL
IFESKTLETEKTLPAALRALKGKAARQCLTDELGLHVQQNRAILDHQQFDYVIRMMNCTL
QDCSSLEEYNIAAALLPLTSAFYRKLAPGVSQFAYTCVQDHPIWTNQQFWETTFYNAVQE
QVRSLYLSAKEDSCAPLLKYKGIVPDDRHQERTAMDLAAEQLRLWPTLSRSTQLELVQRE
ESTVFSQAIHFANLMVNLLVPLDTSKNRLLRASAPGDWESGSNSIVTNSIAGSVAESYDT
ESGFEDSENNDIANSVVRFITRFIDKVCTESGVTQDHIKSLHCMIPGIVAMHIETLEAVH
RESRRLPPIQKPKILRPALLPGEEIVCEGLRVLLDTDGREEATGGLLGGPQLLPAEGALF
LTTYRILFRGTPHDQLAGEQTVMRSFPVASITKEKKITIQNQRQQNMQEGLQITSASFQL
IKVAFDEEVSPEVVEIFKKQLMKLRYPQSIFTTFAFAAGQTAPQIILPKQKEKNTSFRTF
SKTIVKGAKKAGKMTIGRQYLLKRRAGTIVEERVSRPGWNEDDDVSVSDDSELPTSTTLK
ASEKSTMEQLVEKACFRDYQRLALGTISGSSSRSKPEYFRITACXXXXXXXXXXYPGLLV
VPQVVQDSSLPRVARCYRHNRLPVVCWKNSRCSTLLLRSGGFHGKGVVGLFKSQNSPQAA
PTSSLESSSSIEQEKYLQALLNAVSVHQKLSGNNTVRPSLALSPGVWASLRSSTRLVSSP
APFIDVGARLAGKGHSASVSNSGYLQRQLSKHQAALYIFGEKAQLRNFKLEFALNCEFVP
IEFHDIRQVEASFKKLIRACVPSTIPTDSEVTFLKALGDSDWFPQLQRIMQLAMVVSEVL
ENGSSVLVCLEEGWDITTQVTSLVQLLSDPFYRTVEGFRMLIEKEWLSFGHKFSQRSSLT
LNSQGSGFAPVFLQFLDCVHQVHNQYPTEFEFNLYYLKFLAFHYVSNRFKTFLLDSDYER
LEHGTLFDDKGDKHAKKGLCIWECIDRTHKRSPVFFNYLYSPVETEALKPNINISNLQKW
DYYVEETLSTGPSYEWMMLTPRHLPTEDSELSGGAGPQSLRRTVWPCYDDVSSSQPDALT
SLFSEIERLEQKLNQTPEKWQQLWERVTADLQEKPRTHRPQRCPSGSPGILSASVPSCQK
RSLLPLPESSPGEEQNASISPSNGVDRRAATLYSQYTSKGEEHRSFEGTLYKRGALLKGW
KPRWFVLDVTKHQLRYYDSSEDTGCKGHIDLADVETVIPAGPSMGALKHTSDKAFFDLKT
SKRVYNFCAQDGQSAQQWMDRIQSCISDA
Download sequence
Identical sequences ENSEEUP00000007420 ENSEEUP00000007420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]