SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007470 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007470
Domain Number 1 Region: 20-161
Classification Level Classification E-value
Superfamily EF-hand 1.19e-35
Family Calmodulin-like 0.0000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007470   Gene: ENSEEUG00000008225   Transcript: ENSEEUT00000008198
Sequence length 165
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2202:823:9512:-1 gene:ENSEEUG00000008225 transcript:ENSEEUT00000008198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APKKAKKRLEGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNV
KNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVQE
MLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Download sequence
Identical sequences ENSEEUP00000007470 ENSEEUP00000007470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]