SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007511 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007511
Domain Number 1 Region: 43-167
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.33e-23
Family FCH domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000007511
Domain Number - Region: 232-273
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0241
Family FCH domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007511   Gene: ENSEEUG00000008217   Transcript: ENSEEUT00000008242
Sequence length 808
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5588:418:85308:1 gene:ENSEEUG00000008217 transcript:ENSEEUT00000008242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMAHFVESFWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATIEEAYSRSMTKLAKSA
SNYSQLGTFAPVWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVA
GTLEAVQTIQNITQTLQKSKENYNAKCVEQERLKKEGATQREIEKXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHEEFID
NMANTTVESLIQKFAESKGTGKERPGLIEFEECDPAGAVEXXXXXXXXXXXXXXXXXXXX
XXXXXECPDADSLNIPDVDEEGYSIKPEANQNDILSPSDNHFYSSSDSDSEDEEPKKYRI
EIKPVHSNDSHHTAASLDELRVSVGNITLSPAVSVSKKXXXXXXXXXEELAKSRASAASN
ERGPSDLLAWDPLFGSSLEPPAAPPPSASARPTTPLSVGTIVPPPRPASRPKLTSGKLSG
INEIPRPFSLPVTSSASPPPAAPLARAESSSSISSSASVSAANTPTVGVSRGPSPVSLGS
QDTLPVAIALTESVNAYFKGADPSKCIVKITGDMTISFPSGVIKVFTGNPCPAVLCFRVK
HISRLEQILPNAQLDPSQCGSNTKDFWMNMQAVTVYLKKLSEQNPAASYYNVDVLKYQXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXDAEQMKALWKLSGISEKSENGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXRYLADC
Download sequence
Identical sequences ENSEEUP00000007511 ENSEEUP00000007511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]