SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007611 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007611
Domain Number 1 Region: 372-467,495-605
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 1.06e-33
Family Tex N-terminal region-like 0.01
Further Details:      
 
Domain Number 2 Region: 755-911
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.05e-19
Family Tex RuvX-like domain-like 0.014
Further Details:      
 
Domain Number 3 Region: 1302-1393
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000265
Family SH2 domain 0.0033
Further Details:      
 
Domain Number 4 Region: 1203-1260
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000858
Family Cold shock DNA-binding domain-like 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000007611
Domain Number - Region: 926-982
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000711
Family Tex HhH-containing domain-like 0.023
Further Details:      
 
Domain Number - Region: 1031-1115
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0198
Family Tex HhH-containing domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007611   Gene: ENSEEUG00000008265   Transcript: ENSEEUT00000008358
Sequence length 1702
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2070:10591:43036:1 gene:ENSEEUG00000008265 transcript:ENSEEUT00000008358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDFVESEAEESEEEYNDEGEVVPRVTKKFVEEEDDXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
IDDFIVDDDGQPLKKPKWRKKLPGYTDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXVPFIAFYRKEYVEPELHINDLWRVWQWDEKWTQLRIRKENLTRLFEKM
QAYQYEQISADPDKPLADGIRALDTTDMERLKDVQSMDELKDVYNHFLLYYGRDIPNAEE
GEEAGDEQRGPELKQASRRDMYTICQSAGLDGLAKKFGLTPEQFGENLRDSYQRHETEQF
PAEPLELAKDYVCSQFPTPEAVLEGARYMVALQIAREPLVRQVLRQTFQERAKLNITPTK
KGRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XACSRKLYYWLRVAPYRPDQQVEEDDDFMDENQGKGIRVLGIAFSSARDHPVFCALVNGE
GEVTDFLRLPHFTKRRTAWREEEREKKAXAQDIETLKKFLLNKKPHVVTVAGENRDAQML
IEDVKRIVHELDQGQQLSSIGVELIDNELAILYMNSKKSEXXXXXYPPVLRQAVSLARRI
QDPLIEFAQVCSSDEDILCLKFHPLQEHVVKEELLNALYCEFINRVNEVGVDVNRAIAHP
YSQALIQYVCGLGPRKGTHLLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXTDSYIEVLDGSRVHPETYEWKMPDALEYDSAXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXGYGDKHITLYDIRAELSCRYKDLRTAYRSPNTEEVFNMLTKETPETFYIG
KLIICNVTGIAHRRPQGESYDQAIRNDETGLWQCPFCQQDNFPELSEVWNHFDSGSCPGQ
AIGVKTRLDNGVTGFIPTKFLSDKVVKRPEERVKVGMTVHCRIMKIDIEKFSADLTCRTS
DLMDRNNEWKLPKDTYYDFDAEAADHKQEEDMKRKQQRTTYIKRVIAHPSFHNINFKQAE
KMMETMDQGDVIIRPSSKGENHLTVTWKVSDGIYQHVDVREEGKENAFSLGATLWINSEE
FEDLDEIVARYVQPMASFARDLLNHKYYQDCSGGDRKKLEELLIKTKKEKPTFIPYFICA
CKELPGKFLLGYQPRGKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXSNSHAAIDWGKMAEQWLQEKEAERRKQKQRLTPRPSPSP
MIESTPMSIAGDATPLLDEMDR
Download sequence
Identical sequences ENSEEUP00000007611 ENSEEUP00000007611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]