SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007695 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007695
Domain Number 1 Region: 14-270
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.67e-42
Family FCH domain 0.0065
Further Details:      
 
Domain Number 2 Region: 412-500
Classification Level Classification E-value
Superfamily SH3-domain 1.17e-23
Family SH3-domain 0.00065
Further Details:      
 
Domain Number 3 Region: 292-363
Classification Level Classification E-value
Superfamily HR1 repeat 0.00000419
Family HR1 repeat 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007695   Gene: ENSEEUG00000008436   Transcript: ENSEEUT00000008448
Sequence length 508
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5972:4853:82921:1 gene:ENSEEUG00000008436 transcript:ENSEEUT00000008448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDPLADCSYNKMYKSLKEFSQNGENFCKQVTSILQQRANLEISYAKGLQKLAIKLGKAL
QSTKKNCLVSAWAWVSEGMKSAANLHQKLGKAIELEAIKPTHQVLTVHEKKRKSLDNEVE
KTANLVISNWNQQIKATLKKKLMVSTKKHEALFHLVESSKQTMTEKEKQKLLNKLKKSAE
KLAKEDENYYQKNVVGCSARLKWENTLEHCYQSILELEKERIQLLCNNLHQYTQHISVFG
QTLTTCHTQVHCAVSKIDVEKDIQTLMEETAVSSTENKFEFLLTDYFEEESNNAMTKERQ
MSSIKSKLLRLQRDIEKASRDREGLEQMLKVYSDNPSFSDAESQKITAALMDETNLKLDL
LQANSYKLSSVLAELEKRPKPSHPCSASIFKWKEKQQTHSYLKISRPFLMKRLENVVNRA
SSGGLSCPTSTSAASSVAEPGNGLCKALYSFQARQDDELNLEKGDIVTIHNKKEEGWWFG
SLNGKKGHFPAAYVEELPSNTGNTATQA
Download sequence
Identical sequences ENSEEUP00000007695 ENSEEUP00000007695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]