SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007764 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007764
Domain Number 1 Region: 3-190
Classification Level Classification E-value
Superfamily EF-hand 1.42e-45
Family Calmodulin-like 0.0000000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007764   Gene: ENSEEUG00000008548   Transcript: ENSEEUT00000008521
Sequence length 202
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2062:1321:11720:-1 gene:ENSEEUG00000008548 transcript:ENSEEUT00000008521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSKSGALSKEILEELQLNTRFTQEELCAWYQSFLKECPTGRITQQEFAGIYAKFFPDS
DPKAYAQHVFRSFDANSDGTLDFKEYVVALHMTSAGKTTQKLEWAFSLYDVDGNGTISKN
EVLEIVMAIFKMINPEDLKHLPDDENTPEKRAEKIWAFFGKKEDDKLTEEEFIEGTLANK
EILRLIQFEPQKVKERIKEKKP
Download sequence
Identical sequences A0A1S2ZPX1
XP_007522715.1.11023 ENSEEUP00000007764 ENSEEUP00000007764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]