SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007841 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007841
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily PH domain-like 6.71e-48
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000000496
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000007841
Domain Number - Region: 242-339
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00159
Family Extended AAA-ATPase domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007841   Gene: ENSEEUG00000008618   Transcript: ENSEEUT00000008608
Sequence length 353
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5277:43046:116915:-1 gene:ENSEEUG00000008618 transcript:ENSEEUT00000008608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTI
TPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEKM
ELTSTPSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTELECVSSQANA
VHTHKTELNKTIQELEETLKVKEEEIERLKQEIDNARELQEQRDSLTQKLQEVETRNKDL
EGQLSDLEQRLEKSQNEQEAFRNNLKTLLEILDGKIFELTELRDNLAKLLECS
Download sequence
Identical sequences ENSEEUP00000007841 ENSEEUP00000007841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]