SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007861 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007861
Domain Number 1 Region: 73-235
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.88e-48
Family BAR domain 0.0000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007861   Gene: ENSEEUG00000008622   Transcript: ENSEEUT00000008632
Sequence length 553
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7755:37509:98226:-1 gene:ENSEEUG00000008622 transcript:ENSEEUT00000008632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGKSGGAAGLFAKQVQKKFSRAQEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXMHESSKRVSETLQELYSSEWEGHEELEAIVGNNDLLWEDYEEKLADQ
ALRTMENYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKA
QTVFEDLNQELLEELPVLYNSRIGCYVTIFQNISNLRDVFYKEMSKLNHNLYEVMSKLDK
HSNKVFVVKGLSGSSRRSLVISSPVGASTVSSPLMSPTSPSSLYLKSERGSISANEELAP
DPAQGEGSAENKEEPISKEETDDEESEASSSSEEEESQLTCNGLTQARPAPSQSSESQEE
VLPGSPAPSPGRTSSPTEQPSSPPEVILRNRTSSEGSEQPKQKSIQRASAPPSRPPPPRT
TPSPRSSSGSIPTSPTASERDSPSSPTALLGAETPSPQASLESVHDPQLPEKQVRTPKVK
EKESTDNLNPELSTSPTSVNSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXEE
Download sequence
Identical sequences ENSEEUP00000007861 ENSEEUP00000007861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]