SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007905 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007905
Domain Number 1 Region: 28-129,180-304,336-456,556-614
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.44e-33
Family LacY-like proton/sugar symporter 0.086
Further Details:      
 
Domain Number 2 Region: 467-523
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000121
Family Ovomucoid domain III-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007905   Gene: ENSEEUG00000008667   Transcript: ENSEEUT00000008680
Sequence length 726
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4322:10214:74070:1 gene:ENSEEUG00000008667 transcript:ENSEEUT00000008680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTPSKEDTQLFCKNPVHPDRRPSLKTDYSSSEEKQPCCGELKVFLSALSFIYFAKALAE
GYLKSTITQIERRFDIPSSLVGVIDGSFEIGNLLVITFVSYFGAKLHRPKVIGAGCLIMG
VGTLLIAMPQFFMERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCET
DASSSMWVYVFLGNLLRGIGETPIQPLGIAYLDDFASENNAAFYIGCVQTVAIIGPIFGF
LLGSLCAKLYVDIGFVNLDNISITPKDPQWVGAWWLGYLIAGIVSLLAAMPFWYLPKSLP
RPQSTDDSNSSSEKSKFIVGDHTEYQAPHGEKAKITEMARDFLPSLKSLFGNPVYFLYLC
ASTVQFNSLLGMVTYKPKYIEQQYGQSSSKANFVIGLINIPAVALGIFSGGIIMKKFRIG
VHGAAKLYLGSSVFGYLLFLSLFALGCENSDVAGLTVSYQGNKLASYHERDLFSDCNSRC
KCSETKWEPICGENGITYASPCLAGCQTSIRSGKAIVFYNCTCVGNITYKSGNLSGTVGR
CQKDNGCPNMFLYFLVISVITSYTLSLGGIPGYIVLLRCIKPQLKSFALGIHTLAVRVLA
GIPAPVYFGVLIDTSCLKWRFKRCGNRGFCRLYDSNAFRYGIKLNPVHCSNPGLHNTIGT
NNYCLFTTKTHISRTYDDTGHNVHFPKYGSTSHFKEKLCLKTQKLQDQARKNNDVCKYQE
GSLFYK
Download sequence
Identical sequences ENSEEUP00000007905 ENSEEUP00000007905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]