SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007962 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007962
Domain Number 1 Region: 156-234,268-355
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.05e-50
Family SPRY domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007962   Gene: ENSEEUG00000008768   Transcript: ENSEEUT00000008744
Sequence length 358
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_219770:9848:13854:-1 gene:ENSEEUG00000008768 transcript:ENSEEUT00000008744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKLQGHVEPLKKHLEVIQKIKAKEERRVTELKNQMKSELAAVASEFGRLTRFLAEEQAGL
ERRLREIHEVQLGRAGAAASRLAEQAAQLSRLLAEAQERSQQGGLRLLQDIKETFNRCEE
IQLQPPEVWSPDTCQPHSHDFLTDAIVRKMSRMFCQAARVDLTLDPDTAHPALLLSPDRR
GVRLAERRQEVADHPKRFSADCCVLGAQGFRSGRHYWEVEVGGRRGWAVGAARESTHKEK
VGPGGVAVGSGDASSSRHHHRRRRLHLPQQPLLQREVWCVGTNGKRYQAQSSTEQTLLSP
SEKPRRFGVYLDYEAGRLGFYNAETLAHVHTFSAAFLGERVFPFFRVLSKGTRIKLCP
Download sequence
Identical sequences ENSEEUP00000007962 ENSEEUP00000007962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]