SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008048 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008048
Domain Number 1 Region: 447-544
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.24e-39
Family MBT repeat 0.00000777
Further Details:      
 
Domain Number 2 Region: 289-361
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.09e-30
Family MBT repeat 0.00000669
Further Details:      
 
Domain Number 3 Region: 339-415
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.05e-25
Family MBT repeat 0.0000997
Further Details:      
 
Domain Number 4 Region: 703-770
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000214
Family SAM (sterile alpha motif) domain 0.002
Further Details:      
 
Domain Number 5 Region: 556-597
Classification Level Classification E-value
Superfamily CCHHC domain 0.00000353
Family CCHHC domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008048   Gene: ENSEEUG00000008805   Transcript: ENSEEUT00000008836
Sequence length 780
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8597:32146:157215:1 gene:ENSEEUG00000008805 transcript:ENSEEUT00000008836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTESASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDESEMESVKKATA
TTTWMVPTAQEAPTSPPSSRPVFPPAYWTSPPGCPSXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXENKQDARILRGSQRTRRKRRGDSAVLKQALPSKGKKAWCWASYLEE
EKAVAVPAKLFKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCGYRIKLHFDG
YSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKSLFE
NQNITVIPSGFRVGMKLEAVDKKNPAFICVATVTDMVDNRFLVHFDNWDESYDYXXXXXX
XXXXXXXXXXXXXXXXXXXXXYPNVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKKMK
LEVIDKRNPMFIRVATVADTDDHRIKVHFDGWSSCYDYWIDADSPDIHPVGWCSKTGHPL
QPPLSPLELMEPSEHSGCSTPGCKGIGHFKRARHLGPHSAANCPYSEINLNKDRIFPDRL
SGEMPPASPSFPRNKRTDTNEISSSPEIRDQNTEDGKEDFEGRTENEMKTSHKARGAREE
PSVQQAQRRSAVFLSFKSPIPCLPLRWEQQSKLLPTVAGIPASKVSKWSTDEVSEFIQSL
PGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAEKNSHNEL
Download sequence
Identical sequences ENSEEUP00000008048 ENSEEUP00000008048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]