SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008085 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008085
Domain Number 1 Region: 119-444
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.36e-119
Family Myotubularin-like phosphatases 0.000000234
Further Details:      
 
Domain Number 2 Region: 5-114
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-19
Family GRAM domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008085   Gene: ENSEEUG00000008881   Transcript: ENSEEUT00000008874
Sequence length 444
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1726:242:28364:1 gene:ENSEEUG00000008881 transcript:ENSEEUT00000008874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFAELIKTPRVDNVVLHRPFYPAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDK
RFVGPLGTIIIKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSITLMYPFFYRPMFEVI
EDGWHSFLPEQEFELYSSATNEWRLSYVNKDFAVCSSYPPIVIVPKSIDDEALRKVATFR
HGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLINATLRAGKRGYIIDTRSLN
VAQQARAKGGGFEQEAHYPQWRRIHKSIERYHILQESLIKLVEACNDQSHNMDRWLSKLE
ASNWLTHVKEILTTACLAAQCVDREGASILIHGTEGTDSTLQVTSLAQIILEPRSRTIRG
FEALIEREWLQAGHPFQQRCALSAYCNSKQKWESPVFLLFLDCVWQILRQFPCSFEFNEN
FLIMLFEHAYASQFGTFLGNNESE
Download sequence
Identical sequences ENSEEUP00000008085 ENSEEUP00000008085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]