SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008113 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008113
Domain Number 1 Region: 564-699
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-27
Family Phosphotyrosine-binding domain (PTB) 0.00015
Further Details:      
 
Domain Number 2 Region: 432-545
Classification Level Classification E-value
Superfamily SH2 domain 6.73e-21
Family SH2 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008113   Gene: ENSEEUG00000008880   Transcript: ENSEEUT00000008903
Sequence length 704
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3572:60250:80832:-1 gene:ENSEEUG00000008880 transcript:ENSEEUT00000008903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQVMSSPLLARGHTVGLTPCEEPRRVLHPAPSPSLPPQCPYYTTEGWGAQTLMAPVSYK
GPPSRLQQASQADLPSPSEQTSGALADLDSYIDFSLESLNQMILELDPTFQLLPTGTGSP
RAQSPHSTTSWTKKEEPEALXXXXXXXNSTRSKGRDALQRQLSPSVTPSCSPRSVGFLLS
RDIPRETRSSNESLIFSGIQGTGHQRLHPGLLSYPPPSSPSIAIRCMGSKTLGPNVLGSP
RVASLGLEKGLGVLAPQRGSRISVLSASPASDISYTFGSSQSLLYSSTSSHQSSPRSLES
PASSFSSLHSLGPVSLCTKASDLQAPGNSSLSTVQAKATHSPPLGKEHASSCPPSITSMM
DPIVLICLPGPGSSPPQWAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPT
RDMQPTMRFVMDTSKYWFKPSITRDQAIELLKKEEPGAFVVRDSSSYRGSFGLALKVQEA
PAPAHNRPGEDSNDLIRHFLIESSAKGVHLKGADEEPYFGSLSAFVCQHSIMALALPCKL
TIPLKELGGGGGASDPSADCRASSVKKSAGCHALYLSSVSVETLTGALAVKKAISTTLEQ
DVLPTPTVVHFKVTEQGITLTDVQRXXXXXXXXXXXXXXXXXXXXXXXXWQKYCKPSWIF
GFVAKSQTESQENVCHLFAEYDAVQPASQVTSLVSALLQDTERV
Download sequence
Identical sequences ENSEEUP00000008113 ENSEEUP00000008113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]