SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008185 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008185
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily EF-hand 3.65e-41
Family Calmodulin-like 0.00000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008185   Gene: ENSEEUG00000009010   Transcript: ENSEEUT00000008981
Sequence length 126
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_347687:38560:38937:-1 gene:ENSEEUG00000009010 transcript:ENSEEUT00000008981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKQNSKLRPEVLQDLRENTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGD
ASKFAEHVFRTFDTNGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSE
MLEIVQ
Download sequence
Identical sequences ENSEEUP00000008185 ENSEEUP00000008185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]