SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008227 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008227
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 3.01e-51
Family N-terminal domain of cbl (N-cbl) 0.000000567
Further Details:      
 
Domain Number 2 Region: 199-285
Classification Level Classification E-value
Superfamily SH2 domain 1.12e-48
Family SH2 domain 0.00000221
Further Details:      
 
Domain Number 3 Region: 291-369
Classification Level Classification E-value
Superfamily RING/U-box 4.16e-43
Family RING finger domain, C3HC4 0.00000878
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008227   Gene: ENSEEUG00000009028   Transcript: ENSEEUT00000009026
Sequence length 582
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2153:7712:32064:1 gene:ENSEEUG00000009028 transcript:ENSEEUT00000009026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMENLMKK
TKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKAD
AAEFWRRAFGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAI
GYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQ
EQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKG
TEPIVVDPFDPRGSGSLLRQGAEGAPSPNYEDDDDERADDSLFMMKELAGAKVERPPSPF
SVAPQASLPPVPPRLDLLQQRISIPSSTSGLGTASKATSGSLHKDKPLPIPPTLRDLPPP
PPPDRPYSGAAETRPQRRPLPCTPGDCSSRDKLPSVPSSRLGESWLPRPVPKLPVVAPNP
SDLWTGRELTNRHSLPFSLPSQMEPRTDVPRLGNAFSLDTSI
Download sequence
Identical sequences ENSEEUP00000008227 ENSEEUP00000008227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]