SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008231 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008231
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily SH2 domain 1.16e-26
Family SH2 domain 0.00000927
Further Details:      
 
Domain Number 2 Region: 274-377
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.67e-26
Family Protein kinases, catalytic subunit 0.00000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008231   Gene: ENSEEUG00000009043   Transcript: ENSEEUT00000009032
Sequence length 386
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8916:3931:9568:-1 gene:ENSEEUG00000009043 transcript:ENSEEUT00000009032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WYFGKTGRKDAERQLLSSGNPQGAFLIRESETTKGAYSLSILDWDETRGNHVKHYKIRKL
DMGGYYITTRAQFDSVQELVQHYMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKFPIKWTAPEAALYGRFTIKSDVWS
FGILLTELITKGRVPYPGMNNREVLELVEHGYHMPCPPGCPASLYEAMEQTWRLDSEERP
TFEYLQSFLEDYFTSTEPQYQPGDQT
Download sequence
Identical sequences ENSEEUP00000008231 ENSEEUP00000008231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]