SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008254 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008254
Domain Number 1 Region: 29-68
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000916
Family Somatomedin B domain 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000008254
Domain Number - Region: 173-204
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.00549
Family Pyk2-associated protein beta ARF-GAP domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008254   Gene: ENSEEUG00000009069   Transcript: ENSEEUT00000009056
Sequence length 259
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4971:99151:140073:-1 gene:ENSEEUG00000009069 transcript:ENSEEUT00000009056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALCALARLGPGVLAGCTEAGRCCPGRDPTCFAQGWRLDRVYGTCFCDQACRLAGDCCFD
YARACPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXPAFITTSAFNKERTRQAASPHWSTDTEDTGYCMEFKTESLTHHCAVAN
RPLTQWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRCQGTWK
KVRRVDQCSCPAVHSFIFI
Download sequence
Identical sequences ENSEEUP00000008254 ENSEEUP00000008254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]