SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008301 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008301
Domain Number 1 Region: 310-418
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.8e-46
Family ets domain 0.00000201
Further Details:      
 
Domain Number 2 Region: 183-250
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.71e-23
Family Pointed domain 0.0000729
Further Details:      
 
Domain Number 3 Region: 38-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000278
Family Ubiquitin-related 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008301   Gene: ENSEEUG00000009111   Transcript: ENSEEUT00000009109
Sequence length 454
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5451:1192:19982:1 gene:ENSEEUG00000009111 transcript:ENSEEUT00000009109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKREAEELIEIEIDGTEKPECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQ
CSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXPIQWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEIL
WSHLELLRKXXXXXXXXXXXXXXXXXXXVQIIPASVQSAAPTTIKVINGSAKAAKVQRAP
RISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKW
GQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTE
CEQKKRAKMQLHGIAQPVTAVALATASLQAEKDN
Download sequence
Identical sequences ENSEEUP00000008301 ENSEEUP00000008301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]