SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008325 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008325
Domain Number 1 Region: 214-324
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-27
Family DBL homology domain (DH-domain) 0.00066
Further Details:      
 
Domain Number 2 Region: 335-458
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-19
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 109-157
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000249
Family DBL homology domain (DH-domain) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008325   Gene: ENSEEUG00000009136   Transcript: ENSEEUT00000009135
Sequence length 536
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6127:2008:135368:-1 gene:ENSEEUG00000009136 transcript:ENSEEUT00000009135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKRQRQNNFSMFPSPKAWNFRGRKRKQSSPDEDAVSLCSLDINEPSNKRVKPLSRVTSLA
NLIPPVKATPLKRFSQTLQRSISFRSESRPDILNPRPWSRNASSSSTKRRDSKLWSETFD
VCVNQVLTSKEIKRQEAIFELSQGEEDLIEDLKLAKKXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWLPCLSSYDSYCSNQVAAKALLDHKK
QDHRVQDFLQRCLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPNDNSDQQHLEE
AINIIQGIVAEINTKTGESECRYYKERLLYLEEGQKDSLIDSSRVLCCHGELKNNRGVKL
HVFLFQEVLVITRAISHNEQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNER
IKNFFRVSFKNGSQSQTHSLQANDTFNKQQWLNCIRQAKEMVLSAVGQAGVLDSEGPFLH
PTTGSREPQGETKLEQMDQSDSESDCSMDTSEVSLDCERMEQTDSCGNSRHIESNV
Download sequence
Identical sequences ENSEEUP00000008325 ENSEEUP00000008325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]