SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008335 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008335
Domain Number 1 Region: 203-472
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-77
Family Protein kinases, catalytic subunit 0.000000166
Further Details:      
 
Domain Number 2 Region: 111-245
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-37
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 3 Region: 51-132
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000988
Family SH3-domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008335   Gene: ENSEEUG00000009151   Transcript: ENSEEUT00000009146
Sequence length 485
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3224:1057:10501:-1 gene:ENSEEUG00000009151 transcript:ENSEEUT00000009146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPFLRKRLAFLSFFWNKIWPAGGEPVSDGSWSPDAEFPAEPGSPPAPARLFRALSDFRA
RCAGELSVSRGDWLFALQEDGEYLFARRLSSPFCTGLVPITCVAKTSPEPLSDQPWYFGD
ISRTQAQQLLLSAANAPGAFLVRPSESRRGDYSLSVRAQAKVCHYRISMAEDGGLYLQKG
QCFSSLEELLSYYKANWKLLQNPLLQPCMPQKSQEQDQWERPRSEFVLRRKLGQGFFGEV
WEGLWLGSVPVAVKVIKSADMKLDDLAQEIRTLKSLRHERLIRLHAVCSTGEPVYIVTEL
MRKGSLQAYLGGPGGRTLSLPLLLSFACQVAEGMGYLECRRIVHRDLAARNVLVGDNLAC
KVADFGLARLLKDDVYSPSSSSKIPVKWTAPEAANYCIFSQKSDVWSFGVFLYEVFTYGQ
CPYEGMSNHETLQQVMQGYRLPRPPTCPAEVYVLMLECWKGSPEERPAFSVLQEKLGDIS
RCFYP
Download sequence
Identical sequences ENSEEUP00000008335 ENSEEUP00000008335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]