SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008352 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008352
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.05e-31
Family Galectin (animal S-lectin) 0.0000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008352   Gene: ENSEEUG00000009189   Transcript: ENSEEUT00000009164
Sequence length 103
Comment pep:novel scaffold:HEDGEHOG:scaffold_340852:43445:44362:1 gene:ENSEEUG00000009189 transcript:ENSEEUT00000009164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FIVDLMCSMGQDPDIALHFNPRFDQNKVVFNIRKNGSWGTEEFGQGFPFRHGQAFEIMII
ATNGFKVVIGDQKYHHFRYRIPLSEVSRLGVSGNVMLESVNIF
Download sequence
Identical sequences ENSEEUP00000008352 ENSEEUP00000008352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]