SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008365 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008365
Domain Number 1 Region: 303-623
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.93e-85
Family Protein kinases, catalytic subunit 0.00000000166
Further Details:      
 
Domain Number 2 Region: 152-244
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.29e-22
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00011
Further Details:      
 
Domain Number 3 Region: 4-74
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000872
Family PLC-like (P variant) 0.0000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008365   Gene: ENSEEUG00000009161   Transcript: ENSEEUT00000009179
Sequence length 633
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6124:1051:24763:1 gene:ENSEEUG00000009161 transcript:ENSEEUT00000009179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVLMRAAEEPMSEVTVGVSVLAERCKKNS
GKAEFWLDLHPAEVLMTVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCNAAIHKKCIDKIIGRCTGTAANSRDTIF
QKERFNIDMPHRFKVNNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCQKKVANLC
GINQKLLAEALNQVSQRSLRKDSEPEPVGIYQNFEKKLGISGDDGPDSGTYGKIWEGSTK
CTIENFTFHKVLGKGSFGKVLLAELKGRKEFFAIKALKKDVVLIDDDVECTMVEKRVLAL
AWENPFLTHLYCTFQTKEHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIICGLQF
LHSKGIIYRDLKLDNVMLNQNGHIKIADFGMCKEDIVGEKQASTFCGTPDYIAPEILQGL
KYSYSVDWWSFGVLLYEMLIGQSPFHGDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLL
EREPTKRLGVTGRIRSHPFFKTINWTLLEKCEMEPPFKPKVRSPGDYSNFDQEFLNEKPR
LSYSDKNLIDSMDQSAFAGFSFVNPKFERLLEK
Download sequence
Identical sequences ENSEEUP00000008365 ENSEEUP00000008365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]