SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008423 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008423
Domain Number 1 Region: 300-544
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.1e-82
Family Oxysterol-binding protein 0.0017
Further Details:      
 
Domain Number 2 Region: 8-63
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000951
Family Pleckstrin-homology domain (PH domain) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008423   Gene: ENSEEUG00000009223   Transcript: ENSEEUT00000009239
Sequence length 573
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7887:6178:19070:1 gene:ENSEEUG00000009223 transcript:ENSEEUT00000009239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NQGEMAHTCRGTINLATTHFDTENTCVIVLSSGARTYHLKASSEAERQQWMSALGLAKAK
AMRMMSSHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXACRDFLGAAEAHSRRWQRALQYEQEQ
RVRLEETIEQLAKQHNSLERAFRGNASTRSSGPSFEXXXXXXXXXXXXXXXXTEYFDAME
DAESFITVITEAKDDSRKAEGGPGPDPVEWTSADNEPVCASQVPKAPPHIKRRARIPDKP
NYSLNLWSIMKTCIGRELSKIPMPVNFNEPLSMLQRLTEDLEYHQLLDRAVHCASAVEQM
CLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRLEDMGLRSLCEQVSHHPPSAAHHVFS
KHGWTLWQEITISSKFRGKYLSIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWID
QTGDIEIVHRTRDHCQLKFLLYSYFSKEVARKVTGVVSDGHGKAHYVLSGSWDERMECAK
VVQSSPGSPGLEGRQKTVYQTLPAKLLWKKYPL
Download sequence
Identical sequences ENSEEUP00000008423 ENSEEUP00000008423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]