SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008446 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008446
Domain Number 1 Region: 3-58
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000369
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008446   Gene: ENSEEUG00000009284   Transcript: ENSEEUT00000009264
Sequence length 408
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4200:208249:269452:-1 gene:ENSEEUG00000009284 transcript:ENSEEUT00000009264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIHGERQKDKLX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDLIEGSTTS
SSTIHNEAELGDDDVFTTATDSSSNSSQKREQPARTISSPTSCEHQRIYTMGHLHDSYPT
DHYNLEQRQTRTYRQVNFPDDDERIVRINPREKIWMTGYEDYRHAPVRGKYLDSSEDADS
YVRFAKGEVPKHDYNYPYVDSSEFGLGEDAKGRGGSVIKTQPPRSKSRRRKEDGERSRCE
YCRDMFNHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGDYTDPCSCDTS
DEKFCLRWMALIALSFLAPCMCCYLPLRACYNCGVLCRCCGGKHKAAV
Download sequence
Identical sequences ENSEEUP00000008446 ENSEEUP00000008446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]