SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008524 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008524
Domain Number 1 Region: 210-262
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000000000419
Family Arfaptin, Rac-binding fragment 0.0002
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000008524
Domain Number - Region: 322-349
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00167
Family Arfaptin, Rac-binding fragment 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008524   Gene: ENSEEUG00000009355   Transcript: ENSEEUT00000009349
Sequence length 372
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6174:5377:96648:1 gene:ENSEEUG00000009355 transcript:ENSEEUT00000009349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDSPKNSAAEIPVTSNGEVEDSHEHGFNRDLKRSLPAGLGLSETQITSHGYDSPKEGVI
DAGTFEGSPAPPLPSVMSPSRAAAGQLAQQGGDLIVPAGSQKAQTKSGPVILADEIKNPA
MEKLELVRKWSLNTYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEFGYNADTQKLLAKNGETLLGAINFFIAS
VNTLVNKTIEDTLMTVKQYESAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLRQFHIKLKT
PGVDAPSWLEEQ
Download sequence
Identical sequences ENSEEUP00000008524 ENSEEUP00000008524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]