SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008562 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008562
Domain Number 1 Region: 312-478,871-1047
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.02e-122
Family Mammalian PLC 0.00000573
Further Details:      
 
Domain Number 2 Region: 621-736
Classification Level Classification E-value
Superfamily SH2 domain 9.56e-31
Family SH2 domain 0.0000205
Further Details:      
 
Domain Number 3 Region: 528-641
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-25
Family SH2 domain 0.00045
Further Details:      
 
Domain Number 4 Region: 15-130
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-21
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 5 Region: 1062-1162
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.95e-20
Family PLC-like (P variant) 0.0063
Further Details:      
 
Domain Number 6 Region: 769-834
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-16
Family SH3-domain 0.00033
Further Details:      
 
Domain Number 7 Region: 160-309
Classification Level Classification E-value
Superfamily EF-hand 0.00000000682
Family Calbindin D9K 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008562   Gene: ENSEEUG00000009326   Transcript: ENSEEUT00000009389
Sequence length 1267
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8439:12373:187867:1 gene:ENSEEUG00000009326 transcript:ENSEEUT00000009389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAMFNVDTLPEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKDDAN
KWLSGLKILHQEAMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVSSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKLILDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQEVWAQDLSKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCGVEQQRHMARV
FKEVLGDLLLMKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKEEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTVEEELPQDTPPTELHFGEKWFHKKVEKR
TSAEKLLQEYCAETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTMKYY
LTDNLMFTSIYDLIQHYREAHLRCAEFELRLTDPVPNPNPHESKPWYYDGLSRGEAEDML
MRVPRDGAFLIRKREGTDSYAITFRAKGKVKHCRINRDNRLFVLGTSAYFESLVELVSYY
EKHALYRKMKLRYPVTPELLERYNMXXXXXXXXXXXXXXXXXXXXXXXXPQRTVKALYDY
TAKRSDELTFCRGALIHNVSRDPSLQGWWKGDYGTRIQQYFPSNYVEDISTADVEEMEKQ
IIEDNPLGSLCRGILDLNTYNVVKAPQGKNQKPFVFILEPKKQGDPPVEFATDRVEELFE
WFQSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSF
VETKADSVTRQKPIDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTAD
KYMQMNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGR
SIACPFVEVEICGAEYDNNKFKTTVVNDNGLSPIWASTQEKVTFEIYDPNLAFLRFVVYE
EDMFSDPNFLAHATYPIKGIKSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYS
SCRQLRRRQEELNNQLFLYDTHTNLRNANRDALVKEFNVNENQLQLYQERCNRRLKEKRV
SNSKFYS
Download sequence
Identical sequences ENSEEUP00000008562 ENSEEUP00000008562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]