SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008588 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008588
Domain Number 1 Region: 4-219
Classification Level Classification E-value
Superfamily vWA-like 1.67e-58
Family Integrin A (or I) domain 0.00037
Further Details:      
 
Domain Number 2 Region: 244-410
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.39e-24
Family Laminin G-like module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008588   Gene: ENSEEUG00000009231   Transcript: ENSEEUT00000009418
Sequence length 1606
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6811:53464:279070:-1 gene:ENSEEUG00000009231 transcript:ENSEEUT00000009418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLRGNTPACLLWILLLWSGARGCQAQRAGCKTVHYDLVFLLDTSSSVGKEDFEKVRQW
VANLVDTFEVGPDRTRVGVVRYSDRPTPAFQLDHFGSREEVKAAARSLAYHGGNTNTGDA
LRYITAHSFSLQEGGRPGDRAFKQVAILLTDGRSQDLVLGAASAAHRAGIRIFAVGVGEA
LKEELEEIASQPKSAHVFHVSDFNAIDKIRGKLRRRLCENTPHSISMKGHDFKHIDATTK
KITGFDLMDLFSIKEILGKRENGAQSAYVRMGSFPVVQRTEDVFPQGLPDEYAFVTTFRF
RKMSRKEDWYIWQVIDQYGIPQVSIRLDGENKAVEYNAVGTMTDAVRVVFRGPQVNSLFD
RDWHKIALSIQAQNVSLYIDCVLVQTLPIEERENIDIQGKTVIGKRLYDSVPIDXXXXXX
XXXXXXXXXXXXXXXXXXXXXCQVTVVTEPPPQPELPPTSGSEQIGFLKTINCSCLPGEK
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSLGLPGPPGR
EGSKGIRGEPGEPGLPGEVGMRGYQGPPGLPGPPGHEGIPGLQGERGEKGGRGEKGERGL
DGFPGKPGEAGEQGRPGPPGIPGPQGEKGVVGPVGPPGIPGSVVQKEGLKGEQGAPGPRG
HQGPPGPPGAPGLLGLEGKEGPPGLQGPRXXXXXXXXXXXXXXXXXXGPPGPPGTLGFPG
PGGPPGLPGEIGPGSGHSGQVGPPGKDGPSGPPGLPGLKGEPGERGEDGLPGKPGLQGEV
GEQGLAGRPGEKGAAGLPGAPGFPGLRGLKGEQGEKGELGLPGLKGDQGEKGEAGPAGPP
GLPGTIPLFTPQPRIPGEQGQKGEKGDRGSPGEPGSQGHPGELGPRGPAGPPGAKGQDGL
HGTPGVAGNPGPAGLVGAPGPSGSPGSMGPPGIRGPPGKDGERGEKGTAGEEGRPGPAGP
RGNPGSPGLPGPPGKGKDGEPGLRGPPGLPGPLGTKREVRSGAQCQLEXXXXXXXXXXXX
XXXXXXXXXXXXXXGPSGPPGDKGTAXXXXXXXXXXXXXXXXXXGVPGNPGERGPPGKPG
TSPLLSPGDISLLIKDVCNDCPPGPPGLPGLPGFKGDKGLQGKPGREGTEGKKGDAGPRG
LPGPPGTAGPQGCGEHGADGEAGQKGDQGHPGVPGFMGPPGNPGPPGVDGIAGAAGPPGI
QGPPXXXXXXXXXXXXXXXXXXGEEGKEGRDGKPGPPGEPGKAGEPGLPGPEGARGPPGF
KGHTGDLGAPGPRGEPGAIGPPGQEGAPGKDGDTGPIGPQGPRGLRGPAGKNGSPGSPGD
SGPPGNPGPGSRGEGSPGLPGFLGRGXXGEVGEKGVPGKEGTPGKPGEPGLQGERXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXKLAYLLAQMPPAHIKASQGRPGPPGPPGKDGHPGRSGPIGEP
GRPGQGGMEGPSGPIGPKGDRGAKGDPGVPGVGLRGEMGPPGIPGQPGEPGYAKDGLPGA
PGPQGETGPAGHPGPPGPPGPPGQCDPSQCAYFASLAARPGNVKGP
Download sequence
Identical sequences ENSEEUP00000008588 ENSEEUP00000008588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]