SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008606 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008606
Domain Number 1 Region: 350-633
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-79
Family Protein kinases, catalytic subunit 0.0000000373
Further Details:      
 
Domain Number 2 Region: 797-938
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 4.84e-57
Family FAT domain of focal adhesion kinase 0.00000686
Further Details:      
 
Domain Number 3 Region: 70-189
Classification Level Classification E-value
Superfamily Second domain of FERM 5.89e-42
Family Second domain of FERM 0.0000203
Further Details:      
 
Domain Number 4 Region: 2-69
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.2e-22
Family First domain of FERM 0.00062
Further Details:      
 
Domain Number 5 Region: 193-298
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000123
Family Third domain of FERM 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008606   Gene: ENSEEUG00000009385   Transcript: ENSEEUT00000009438
Sequence length 941
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2942:6671:102410:1 gene:ENSEEUG00000009385 transcript:ENSEEUT00000009438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVITSILLSGRIGPNIQLADCYGLRLKHMKSDEIHWLHPQMTVGEVQDKYECLHVEAEWR
YDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGCLELRRFFK
DMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYASLREEECVM
KFFNTLAGFASIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXSLSIKTSSLAEAENMADLIDGYCRLQGEHSGSLILHPRK
DGEKRNSPPQIPMLSLEARRSQLSESCSIESDIYAEIPDDTLRRSGGPQYGIAREDVVLS
RILGEGFFGEVYEGVYTNHKREKVNVAVKTCKKDCTLDNKEKFMSEAVIMRNLDHPHIVK
LIGIIEEEPTWIVMELYPYGELGHYLERNKSSLKVLTLVLYSLQICKAMAYLESINCVHR
DIAVRNILVASTECVKLGDFGLSRYIEDEEYYKASVTRLPIKWMSPESINFRRFTTASDV
WMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTRCWDYDPSE
RPRFTELVCSLSDIYQMEKDITIEQERNIRYRPPKILEPTAFQEPPPKPSRPKYRPPPQT
NLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLQRHNVFKRHSMREEDFVRPS
SREEAQQLWEAERVKMRQILDRQQKQMVEDYQWLRQEEKSLDPMVYLNDKSPLTPEKEAG
YTEFTGPPQKPPRLGAQXIQPTAHLDRTDDQVYLNVMELVRAVLELKNKLTQLPPEGYVV
VVKNVGLTLRKLIGSVDDILPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAITSL
SEECKRQMLAASHTLAVDAKNLLDAVDQARVLADLARPPPE
Download sequence
Identical sequences ENSEEUP00000008606 ENSEEUP00000008606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]