SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008751 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008751
Domain Number 1 Region: 641-692
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000344
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0099
Further Details:      
 
Domain Number 2 Region: 931-973,1004-1054
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000338
Family DBL homology domain (DH-domain) 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000008751
Domain Number - Region: 151-219
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00155
Family Ankyrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008751   Gene: ENSEEUG00000009521   Transcript: ENSEEUT00000009603
Sequence length 1686
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_325:11940:102305:1 gene:ENSEEUG00000009521 transcript:ENSEEUT00000009603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAPSFSQGQTAVYAEFDQKVYLPKDAEFYFVYDGAQQRHVVMAQRVGDNVLQASLPGHGT
QEAVTVTVCLCSEGYSPVTVGCGSVTYVDNTACRLARLLVTPAGRLTVGSHHSLLTPFAL
TAGDPPALDEALVLALTHLRLPPGWTVLGNPPPEVPLHRESLLHLTVRWGLVKLSQFLLG
LPGGVQAWTLPNEEGATPLDLALHGGHAKLTEDIANLQARRSPGFSCVQLSEDAFLQYIH
TSGTLTLTVNHTAKHLLEADIRLFRKYFWDRAVLTKAIKEHEAKPTESADTPSRATETEE
GMSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDHSFDVLKKPKQPSTFLAVGPLSD
RLNGDDEVYANCMVTDQVGDLDTSHINIEGLAANASESPGSALGPQSCRQKLPTETGAGL
YPPKETKAAAPDSGAQQPRASPSSRAPDLRLPFGLPGSDKEQSHVKKRSSSLDALDADTE
GRGPSGWPHRHCASVSQSVSGTGLPSGRELDSWETSPEADLNISRTESLSLSSGLQFKES
LLSGVRSRSYSCSSPKVSLGRSPLVRDFTLCSSKEQRAYSLPEPPAEERIQEEEWDKSML
PAKSESEKYKVSRTFSFLMNRMTSPRSKSKTKTKDAKEKEKPSQHQFVPGTFSGALQCSV
CDKTILGKESLQCSSCCASVHKGCKDAASPCTKKLQEKYNKNKAQSILGXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFSEENADNMKRVYGEFCSHHKEAISLFKEL
QQNKKFQNFIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTEEHKDLC
RALGLIKDVIAAVDVRVSQYEKSQKWLEILSKIESKTFTKLKSGHVFRKQSLVSRDRKLL
HEGLVYWKTAAGRFKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDGSTCPVSCQSEVAQAIQNLTRLLYSLQX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXADLDPFQTEFQPADDASPHPPPAAVDGKYTAECPGDRT
RGGDWS
Download sequence
Identical sequences ENSEEUP00000008751 ENSEEUP00000008751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]