SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008816 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008816
Domain Number 1 Region: 231-369
Classification Level Classification E-value
Superfamily PH domain-like 6.82e-33
Family Pleckstrin-homology domain (PH domain) 0.0000323
Further Details:      
 
Domain Number 2 Region: 60-151
Classification Level Classification E-value
Superfamily Sec7 domain 3.53e-27
Family Sec7 domain 0.0000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008816   Gene: ENSEEUG00000009668   Transcript: ENSEEUT00000009674
Sequence length 392
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3366:53546:114225:1 gene:ENSEEUG00000009668 transcript:ENSEEUT00000009674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLCHPDPVGLSSVETEELQKIRWHRQQLLEDIQKLKEEIADVFAQIDCFETAEESRLAQ
KEKELCTGRKKFNMDPVKGIQYLIEHKLLGPDVQHIAQFLYKGEGLNKTAIGIYLGEREP
VNLQVLQAFVDHHEFANLNLVQALRQFLWSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLFDSIKS
EPFSIPEDDGNDLTHTFFNPDCEGWLLKLGGRVKTWKRRWFILTDSCLYYFEFTTDKEPR
GIIPLENLSVQKVDDPKKPFCLELYNPACRGQKIKACKTDGDGKVVEGKHESYRISASSA
EERDQWIQAASITRVPYYDLVSARKKKIAGKH
Download sequence
Identical sequences ENSEEUP00000008816 ENSEEUP00000008816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]