SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008861 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008861
Domain Number 1 Region: 20-266,293-344
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.85e-104
Family Calpain large subunit, catalytic domain (domain II) 0.000000000454
Further Details:      
 
Domain Number 2 Region: 514-682
Classification Level Classification E-value
Superfamily EF-hand 2.59e-39
Family Penta-EF-hand proteins 0.0000586
Further Details:      
 
Domain Number 3 Region: 372-494
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 3.53e-38
Family Calpain large subunit, middle domain (domain III) 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008861   Gene: ENSEEUG00000009691   Transcript: ENSEEUT00000009720
Sequence length 682
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3937:39078:165094:1 gene:ENSEEUG00000009691 transcript:ENSEEUT00000009720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYFYRTSGPKDLTTPKDTHITHSSGLNFEQLRQECLKKAILFEDADFPANSSSLFYSEM
PQIPIVWKRPGEIVKNPAFIIGGATRIDICQGELGDCWLLAAIASLTLNEKALARVIPQD
QSFGPGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLIFLHSADHNEFWSALLEKAYAKL
YGSYEALKGGSAIEAMEDFTGGVSEIFTTKDSPENFYQILDKALKRGSLVSCSIDIKIAT
ESEARTPFGLIKGHAYTVTGIDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSEWHSVN
PAEQKRLCYTALDDGEFWMAFKDFRVHFDKVEICNLTPDALEENTXXXXXXXXXXXXXXX
XXXXXXXXXXXXTFWTNPQIKLSLTEKDDGQEESTFLVALMQKDRRKLKRFGANVLTIGY
AIYQCPKKDEHLNKDYFRYHVSQARSKTFINLREVSDRFQLPPGEYILIPSTFEPHQEAD
FCLRIFSEKKVITQDMDRNVNIDLPKPQKLDPPEQETEEELQFRALFQQVACEEMEVTAK
ELEYVLNAVLQKKKNIKFTKLSWISCKNIISLMDTNGNGKLEFDEFKVFWNKLKKWTNLF
LQFDADKSGTMSSYELRTALKAAGFQLGSHLLRLIVLRYADENLQLGFDDFLNCLVRLEN
ASRVFQALSMKNKDFIHLNINE
Download sequence
Identical sequences ENSEEUP00000008861 ENSEEUP00000008861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]