SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008898 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008898
Domain Number 1 Region: 314-492
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-50
Family Protein kinases, catalytic subunit 0.000000287
Further Details:      
 
Domain Number 2 Region: 153-252
Classification Level Classification E-value
Superfamily SH2 domain 2.91e-20
Family SH2 domain 0.0000485
Further Details:      
 
Domain Number 3 Region: 33-117
Classification Level Classification E-value
Superfamily SH3-domain 8.01e-18
Family SH3-domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008898   Gene: ENSEEUG00000009758   Transcript: ENSEEUT00000009762
Sequence length 500
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4036:1164:18095:1 gene:ENSEEUG00000009758 transcript:ENSEEUT00000009762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVVSSKKMAKGKGKDQWSPVKLCTQSKEPPPLPPLVLFNHLTPAPPDPQLDQEEHFAVA
LYDYMARNNRDLQMLKGEKLQILTQTGDWWLARSLITGREGIIPSSFVTRVEPLEVEXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSFSLSVKDVTTQGEVIKHYKIRSLDKG
GYYISPRISFPTLQALVQHYSNKGDGLCQRLTQPCMRPAVQNSWAQDEWEIPRQSLRLVR
KLGSGQFGEVWMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXCLLDFLKTDEGSRLSLSRLIDMSAQIAEGMAYIERMNSIHRDLRAAN
ILVSEALCCKVADFGLARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWSFGVLL
MEIITYGRVPYPGMSNPEVIRNLERGYRMPRPDTCPPELYRGVIMQCWHSQPEDRPTFEY
LQSVLEDFYIATEQQYELQP
Download sequence
Identical sequences ENSEEUP00000008898 ENSEEUP00000008898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]