SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008940 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008940
Domain Number 1 Region: 74-158
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000421
Family PDZ domain 0.024
Further Details:      
 
Domain Number 2 Region: 549-597
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000239
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008940   Gene: ENSEEUG00000009826   Transcript: ENSEEUT00000009810
Sequence length 863
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6391:41092:84111:-1 gene:ENSEEUG00000009826 transcript:ENSEEUT00000009810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKPFFPFQTLQGFEEDEDEHIHIQQWALTEGRLKVTLLECSRLLIFGSYDRETNVHCTLE
LSSGVWEEKQRSSIKTVELIKGNLQSVGLTLRLVQSTDGYAGHVIVETVAPNSPAAIADL
QRGDRLIAIGGVKITSTLQVLKLIKQAGDRVLVYYERPVGQSNQGAVLQDTLGQLEENFL
PGSCPPSYEEETAGLAVDAENRDLDSEFEDLASDVRAQNEFRDDAQPLTHSPKRTPTTLS
VKPLGAISPVLNRKLATGSHPPPPKLPSKEGNKPSTLKASEVPDSAQVSKPTQGSTLKPP
VPPRPQLKVPLPSTDPPNQTDADVLSEKPEKVLPPPAVDKAAEKQVKNPDHVEDAAACKQ
FLAKQEVAKDIPAESSCPPKDSSDDPQTWESSEIPYRNKLGKWTRTRATCFFDIEACHRY
LNVALWCKDPFKLGGLICLGHVSLKLEEVALGCLVTSNMEYLSRFRLEAPSPKAMATRTA
LRNLSVQKGFNDKFCFGDITLHFKYLKEGETDHHLITNLEKEKEPYMVEEVSALPKEEHV
VGPVGLTENKHSFQDTQFQNPTWCDYCKKKVWTKAASQCMFCAYVCHKKCQEKCLAETPL
CGATDRHIDRALRNPRPEGPEPPLGLPPRVDVETSKSVNKTTGLTRHIINTSSRLLNLRQ
VSKTRLSEPGTDLVEPSPKHTPNTSDNEGSDTEVCGPNSPSKRGNNTEIKLVRKEGGLDD
SVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSE
LSQLIDSQPFSNISDDLFGPESV
Download sequence
Identical sequences ENSEEUP00000008940 ENSEEUP00000008940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]